PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0438s0160.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 514aa    MW: 56348.7 Da    PI: 5.2632
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0438s0160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.1e-39152212262
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  SapurV1A.0438s0160.1.p 152 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 212
                             7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30149209IPR003851Zinc finger, Dof-type
PfamPF027015.8E-32154210IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.817156210IPR003851Zinc finger, Dof-type
PROSITE patternPS013610158194IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MSEPKDQAFK LFGKTIQVPE ISDTTTTTTT AEDDDGDDDS QDQDRPSCAN SSLDETNTTD  60
DYNNNDKRDD GDEDAETDDK DSTEKTPIEK HEDGASPVAT KESSNPDATS GTSENRKTPS  120
VEKESTALKT TSKTEEEQSD TSNSQEKTLK KPDKIIPCPR CNSMDTKFCY YNNYNVNQPR  180
HFCKNCQRYW TAGGTMRNVP VGAGRRKNKN SASHYRHITI PEALQNVRTD VPNGVHHPSL  240
QTNGTVLTFA SDTRLHESMA SVLNLGDEAM RNCTMNVFHK PEALRIPVSY GGGENGDDHS  300
NGSSVMVSNS SDEAGKSVSK ESAMQSCQGY PPQIPCFSGV PWPYPWNSAQ WSSPVPPPAF  360
CPSSFPMPFY PAPAYWGAVP GAWNIPWLPQ PSSPKQTSLP SDPNPPTLGK HSRDENTLKP  420
SNSNEELVKE NNTERCHLWI PKTLRIDDPG EAAKSSIWTT LGIKNDKPGS FGGRGLFKAF  480
DSKVEKNRAA ETSPVLHANP AALSRSLKFH ENS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323863.10.0hypothetical protein POPTR_0017s12080g
TrEMBLB9IJZ20.0B9IJZ2_POPTR; Uncharacterized protein
STRINGPOPTR_0017s12080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-111cycling DOF factor 2